Glucagon Like Peptide 2 (GLP2)
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.

Organism species: Homo sapiens (Human)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins SPD059Hu01 Synthetic Glucagon Like Peptide 2 (GLP2) Immunogen; Blocking Peptide.
CPD059Hu21 OVA Conjugated Glucagon Like Peptide 2 (GLP2) Immunogen; SDS-PAGE; WB.
CPD059Hu22 OVA Conjugated Glucagon Like Peptide 2 (GLP2) Immunogen; SDS-PAGE; WB.
RPD059Hu01 Recombinant Glucagon Like Peptide 2 (GLP2) Positive Control; Immunogen; SDS-PAGE; WB.
Antibodies PAD059Hu01 Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) WB; IHC; ICC; IP.
PAD059Hu08 Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) WB; IHC; ICC; IP.
Assay Kits CED059Hu ELISA Kit for Glucagon Like Peptide 2 (GLP2) Enzyme-linked immunosorbent assay for Antigen Detection.

Organism species: Mus musculus (Mouse)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins CPD059Mu21 OVA Conjugated Glucagon Like Peptide 2 (GLP2) Immunogen; SDS-PAGE; WB.
RPD059Mu01 Recombinant Glucagon Like Peptide 2 (GLP2) Positive Control; Immunogen; SDS-PAGE; WB.
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits CED059Mu ELISA Kit for Glucagon Like Peptide 2 (GLP2) Enzyme-linked immunosorbent assay for Antigen Detection.

Organism species: Rattus norvegicus (Rat)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins CPD059Ra21 OVA Conjugated Glucagon Like Peptide 2 (GLP2) Immunogen; SDS-PAGE; WB.
Antibodies PAD059Ra08 Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) WB; IHC; ICC; IP.
Assay Kits CED059Ra ELISA Kit for Glucagon Like Peptide 2 (GLP2) Enzyme-linked immunosorbent assay for Antigen Detection.

Organism species: Cavia (Guinea pig )

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer

Organism species: Oryctolagus cuniculus (Rabbit)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer

Organism species: Rhesus monkey (Simian)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer

Organism species: Canis familiaris; Canine (Dog)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins CPD059Ca21 OVA Conjugated Glucagon Like Peptide 2 (GLP2) Immunogen; SDS-PAGE; WB.
Antibodies PAD059Ca08 Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) WB; IHC; ICC; IP.
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer

Organism species: Sus scrofa; Porcine (Pig)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits CED059Po ELISA Kit for Glucagon Like Peptide 2 (GLP2) Enzyme-linked immunosorbent assay for Antigen Detection.

Organism species: Bos taurus; Bovine (Cattle)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer

Organism species: Chicken (Gallus)

CATALOG NO. PRODUCT NAME APPLICATIONS
Proteins n/a Complete Antigen of Glucagon Like Peptide 2 (GLP2) Antigenic Transformation Customized Service Offer
Antibodies n/a Monoclonal Antibody to Glucagon Like Peptide 2 (GLP2) Monoclonal Antibody Customized Service Offer
n/a Polyclonal Antibody to Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody Customized Service Offer
Assay Kits n/a CLIA Kit for Glucagon Like Peptide 2 (GLP2) CLIA Kit Customized Service Offer
n/a ELISA Kit for Glucagon Like Peptide 2 (GLP2) ELISA Kit Customized Service Offer